(data stored in ACNUC7421 zone)

EMBL: CP000251.PE123

CP000251.PE123       Location/Qualifiers
FT   CDS             147078..147431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79901.1"
FT                   /translation="MNSTFARAAACAALLAAAGCRSAFAPEPVLKLSSAPAAEHPATVV
FT                   QAAELRSGPDGLAKVLGTVAAGTTVTASDKPIRGFLRVRTADGKSGYVPQAAVSATAAA
FT                   SAPAPAPAGAVAP"
     MNSTFARAAA CAALLAAAGC RSAFAPEPVL KLSSAPAAEH PATVVQAAEL RSGPDGLAKV        60
     LGTVAAGTTV TASDKPIRGF LRVRTADGKS GYVPQAAVSA TAAASAPAPA PAGAVAP          117
//

If you have problems or comments...

PBIL Back to PBIL home page