(data stored in ACNUC7421 zone)

EMBL: CP000251.PE127

CP000251.PE127       Location/Qualifiers
FT   CDS             149407..150213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79905"
FT                   /db_xref="GOA:Q2IM71"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79905.1"
FT                   /translation="MADETTRARAGSGAKALLAWVAILGLAGVVAWLASERNARTWYLV
FT                   PDEGRLVVMKGLMLPVGRQAFATDDPALAAAYAPLVPPPGKPLPAERAFEERSLLDQGL
FT                   FDLLAGWAREEVATGDPARLERGLGYLGRAERLAGISPAQRDELGAIRAESGYHEARRL
FT                   LERAAAELRDAAEKLRVTAGSRSSRAMDAQLLLKQLEPAVDATLGAIRTAARAEPAAAE
FT                   QGAGTPPAAGEPAPAAAPAPDHAPAAPPAAAPAGPAAQLPPSGEGR"
     MADETTRARA GSGAKALLAW VAILGLAGVV AWLASERNAR TWYLVPDEGR LVVMKGLMLP        60
     VGRQAFATDD PALAAAYAPL VPPPGKPLPA ERAFEERSLL DQGLFDLLAG WAREEVATGD       120
     PARLERGLGY LGRAERLAGI SPAQRDELGA IRAESGYHEA RRLLERAAAE LRDAAEKLRV       180
     TAGSRSSRAM DAQLLLKQLE PAVDATLGAI RTAARAEPAA AEQGAGTPPA AGEPAPAAAP       240
     APDHAPAAPP AAAPAGPAAQ LPPSGEGR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page