(data stored in ACNUC7421 zone)

EMBL: CP000251.PE129

CP000251.PE129       Location/Qualifiers
FT   CDS             153142..153669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79907"
FT                   /db_xref="GOA:Q2IM78"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79907.1"
FT                   /translation="MTEPRRYERIDVELPCRLYIPGERGLKFEAHCTSRNLGLGGVFLS
FT                   SSFLLREGLELFVELGLPGGPLAIRARVAHTVPGDDPELEAGFGVEFLDVDAAGRETLL
FT                   RYFTPLRYHEFYRAFAGEFPHLRERVPVADVALLLNLWEEWKVRGEGGPAFTASGAPPA
FT                   PARAGAARRARR"
     MTEPRRYERI DVELPCRLYI PGERGLKFEA HCTSRNLGLG GVFLSSSFLL REGLELFVEL        60
     GLPGGPLAIR ARVAHTVPGD DPELEAGFGV EFLDVDAAGR ETLLRYFTPL RYHEFYRAFA       120
     GEFPHLRERV PVADVALLLN LWEEWKVRGE GGPAFTASGA PPAPARAGAA RRARR            175
//

If you have problems or comments...

PBIL Back to PBIL home page