(data stored in ACNUC7421 zone)

EMBL: CP000251.PE136

CP000251.PE136       Location/Qualifiers
FT   CDS             complement(161162..162403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79914"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79914.1"
FT                   /translation="MSLPLRRAAVLLLAAACTPSTAPAPAPAAPPANHVARGTITPARY
FT                   VPPPARGARVRPEACLPGEPFAAPSALAEEAVAALDAGARERALACADEALRLSPRMVP
FT                   ALTARGAALAALDRLDEARLAFARALAVDPDEPEALLGAAELHVRRLGSARDALEAGLE
FT                   YAVRGVRSATRPPRKDKDLAARLELVAGMAENDLGRSHLALAHLERALAVRPKDPDALY
FT                   ERGVALFELCRFGDARRAFERALAIAPDDPWAIHQLGLVAERTGEGRRAAALLARARSL
FT                   APDDFKDELAVDAGAFRAEVEAAVAALPAAEREALKLAPVEIQDLPDTEDLTAVEPPLS
FT                   PSILGLYRGPPADEACTEADGPRCRSIVFYRKNLLRFARDRAELTEQVRVTLLHELGHL
FT                   HGESDDELRDRGLE"
     MSLPLRRAAV LLLAAACTPS TAPAPAPAAP PANHVARGTI TPARYVPPPA RGARVRPEAC        60
     LPGEPFAAPS ALAEEAVAAL DAGARERALA CADEALRLSP RMVPALTARG AALAALDRLD       120
     EARLAFARAL AVDPDEPEAL LGAAELHVRR LGSARDALEA GLEYAVRGVR SATRPPRKDK       180
     DLAARLELVA GMAENDLGRS HLALAHLERA LAVRPKDPDA LYERGVALFE LCRFGDARRA       240
     FERALAIAPD DPWAIHQLGL VAERTGEGRR AAALLARARS LAPDDFKDEL AVDAGAFRAE       300
     VEAAVAALPA AEREALKLAP VEIQDLPDTE DLTAVEPPLS PSILGLYRGP PADEACTEAD       360
     GPRCRSIVFY RKNLLRFARD RAELTEQVRV TLLHELGHLH GESDDELRDR GLE              413
//

If you have problems or comments...

PBIL Back to PBIL home page