(data stored in ACNUC7421 zone)

EMBL: CP000251.PE137

CP000251.PE137       Location/Qualifiers
FT   CDS             complement(162569..163489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79915"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79915.1"
FT                   /translation="MRGAPDIREVQDHLFDRLARGQLLLLVGAGASRWAGLPSWREAVA
FT                   ALARDLVPVLRERLPDAPARFSPPGPDDPVALETLLRVPEAHRALCGEARLVERLAALF
FT                   DTSGIDPAGLPLHRLLVRLAGFVPALYTTNFDDLLERTFAWAGRACQVVAAPDDLQRWR
FT                   LDPAGGRFVSRFPVYKLHGTLDRPATLVVSETDFQRRASLAAHAIDLRFCSDAVGRELL
FT                   LVGYGFNDPNLRWIWTKLRDLEVLPVAWFLELGTSTDLDLATFELDRIARVDLRASDPV
FT                   HPPELLAFLGALADRCEAALAPLPR"
     MRGAPDIREV QDHLFDRLAR GQLLLLVGAG ASRWAGLPSW REAVAALARD LVPVLRERLP        60
     DAPARFSPPG PDDPVALETL LRVPEAHRAL CGEARLVERL AALFDTSGID PAGLPLHRLL       120
     VRLAGFVPAL YTTNFDDLLE RTFAWAGRAC QVVAAPDDLQ RWRLDPAGGR FVSRFPVYKL       180
     HGTLDRPATL VVSETDFQRR ASLAAHAIDL RFCSDAVGRE LLLVGYGFND PNLRWIWTKL       240
     RDLEVLPVAW FLELGTSTDL DLATFELDRI ARVDLRASDP VHPPELLAFL GALADRCEAA       300
     LAPLPR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page