(data stored in ACNUC7421 zone)

EMBL: CP000251.PE141

CP000251.PE141       Location/Qualifiers
FT   CDS             166757..167617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79919"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79919.1"
FT                   /translation="MGAGTRPGEDLAIRERSQGELDARATALRALARSGVPFLVAGAYA
FT                   FFEYTGIFRDTKDLDLFLREQDLDAAFRVLEDAGFRTEITDSGWIGKAWQGEWFVDLIF
FT                   SSGNGVAVVDDLWFTHARPGRVMDVEVLLAPPEEMIWSKSFVLERERYDGADVNHLLHA
FT                   CGAGMDWDRLLRRFDRYWEVLFSHLLLFQFAYPGARSIVPDRVIEELVGRTLENLRSGD
FT                   HPVAMCRGSLMSRVQYVHDVERLGLHDGRRWDEAERGPAGRAGHGGAAGADAAGGADVS
FT                   PGGGG"
     MGAGTRPGED LAIRERSQGE LDARATALRA LARSGVPFLV AGAYAFFEYT GIFRDTKDLD        60
     LFLREQDLDA AFRVLEDAGF RTEITDSGWI GKAWQGEWFV DLIFSSGNGV AVVDDLWFTH       120
     ARPGRVMDVE VLLAPPEEMI WSKSFVLERE RYDGADVNHL LHACGAGMDW DRLLRRFDRY       180
     WEVLFSHLLL FQFAYPGARS IVPDRVIEEL VGRTLENLRS GDHPVAMCRG SLMSRVQYVH       240
     DVERLGLHDG RRWDEAERGP AGRAGHGGAA GADAAGGADV SPGGGG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page