(data stored in ACNUC7421 zone)

EMBL: CP000251.PE146

CP000251.PE146       Location/Qualifiers
FT   CDS             171027..171911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0147"
FT                   /product="uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79924"
FT                   /db_xref="GOA:Q2IM96"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79924.1"
FT                   /translation="MTATVSHAGPQVVILTGVSGSGKSTALRALEDAGFYCVDNLPIVF
FT                   LEKLLELSGHTAGEVSRMALVVDAREGRFLVEAPRVIRELRQKGADVEVLFLDASDEAL
FT                   VRRYSETRRRHPLAGEGGTVPDGIAAERLALADVRGIADEVIDTTTLNVHELKRLVTRR
FT                   FVAGDGAKLGVTLVSFGFRFGIPTHADLVLDVRFLPNPFFVPELKPHPGTDPRVAEFVL
FT                   GQADAKAFLERLVDLLGFLLPRYRNEGKSYLTIAIGCTGGKHRSVALAAALAERLEGSG
FT                   QPVRLWHRDVEKE"
     MTATVSHAGP QVVILTGVSG SGKSTALRAL EDAGFYCVDN LPIVFLEKLL ELSGHTAGEV        60
     SRMALVVDAR EGRFLVEAPR VIRELRQKGA DVEVLFLDAS DEALVRRYSE TRRRHPLAGE       120
     GGTVPDGIAA ERLALADVRG IADEVIDTTT LNVHELKRLV TRRFVAGDGA KLGVTLVSFG       180
     FRFGIPTHAD LVLDVRFLPN PFFVPELKPH PGTDPRVAEF VLGQADAKAF LERLVDLLGF       240
     LLPRYRNEGK SYLTIAIGCT GGKHRSVALA AALAERLEGS GQPVRLWHRD VEKE             294
//

If you have problems or comments...

PBIL Back to PBIL home page