(data stored in ACNUC7421 zone)

EMBL: CP000251.PE15

CP000251.PE15        Location/Qualifiers
FT   CDS             19187..19912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79793.1"
FT                   /translation="MALPPQKPGRPAGPPPSAEEAARAARHATDELTDETAKLEEELEA
FT                   LKARYEQYFLGTERREPARWRDEVRKKVLRLKGAFTRNTGLRFRIQSLHARYLSYERLW
FT                   QRSVREREEGTYRRDLVKARRRAGEAEAAPGNAAAPAPAATPSPSVNASAPPARTPAPP
FT                   TSAPPAGGDEARMRALYDAYIAAKRQCNEDVSRLSYDVVARSVAKQVPEVMARFKAKAV
FT                   DFRVEVKDGKAILKAIPRV"
     MALPPQKPGR PAGPPPSAEE AARAARHATD ELTDETAKLE EELEALKARY EQYFLGTERR        60
     EPARWRDEVR KKVLRLKGAF TRNTGLRFRI QSLHARYLSY ERLWQRSVRE REEGTYRRDL       120
     VKARRRAGEA EAAPGNAAAP APAATPSPSV NASAPPARTP APPTSAPPAG GDEARMRALY       180
     DAYIAAKRQC NEDVSRLSYD VVARSVAKQV PEVMARFKAK AVDFRVEVKD GKAILKAIPR       240
     V                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page