(data stored in ACNUC7421 zone)

EMBL: CP000251.PE152

CP000251.PE152       Location/Qualifiers
FT   CDS             174724..176523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0153"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79930"
FT                   /db_xref="GOA:Q2IM99"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79930.1"
FT                   /translation="MSRSSATTLVGIGASPGIAIGRCWTIERRRVRTPKRRLTPEEVEG
FT                   ELARLRTSLEISDVQLAEVRGKVEEAQVPGSAEHTAIIDMHRMMLKDEMLVLEAQRQIR
FT                   EERLNAEWAVKRATRKIKNAFHEQADDYFKERRADVDFVGERIIKNLLGQAPDVEDVPP
FT                   EGVIVVAHDLSPADTALLLHEHKVAAFVTDAGAKTSHTAIVARALEVPAVVGVGRVTAV
FT                   AERGDWIVVDGARGLVVINPSPGERAGYEAAREKQLAGEQALLATRDLPARTLDDLTVR
FT                   LAGNIEFAEEVPSLLAHGGEAVGLYRTEFLFMGRSDLPGEEEHYQNYRRILEALAPRPV
FT                   TIRTFDLGGDKLPAGMRVTAENPALGLRAIRYCLRQPDMFRAQLRALLRASVHGNLRVM
FT                   FPMISGVAELRAAKHALRQAADELRAEGVPFRQVPVGIMVELPSAAMIADRLAAECDFF
FT                   SIGTNDLIQYTIGIDRQDKDVAYLYKPLHLAVLRLLKLICDAGRAAGVPVSMCGEMAGE
FT                   PVNALVLLGLGVSELSMNGPSIPLVKRVVRAARAEEGRALVDRLLALTTADDIEHEVQA
FT                   EMARRFPGLLDGDDEGPEPAGQG"
     MSRSSATTLV GIGASPGIAI GRCWTIERRR VRTPKRRLTP EEVEGELARL RTSLEISDVQ        60
     LAEVRGKVEE AQVPGSAEHT AIIDMHRMML KDEMLVLEAQ RQIREERLNA EWAVKRATRK       120
     IKNAFHEQAD DYFKERRADV DFVGERIIKN LLGQAPDVED VPPEGVIVVA HDLSPADTAL       180
     LLHEHKVAAF VTDAGAKTSH TAIVARALEV PAVVGVGRVT AVAERGDWIV VDGARGLVVI       240
     NPSPGERAGY EAAREKQLAG EQALLATRDL PARTLDDLTV RLAGNIEFAE EVPSLLAHGG       300
     EAVGLYRTEF LFMGRSDLPG EEEHYQNYRR ILEALAPRPV TIRTFDLGGD KLPAGMRVTA       360
     ENPALGLRAI RYCLRQPDMF RAQLRALLRA SVHGNLRVMF PMISGVAELR AAKHALRQAA       420
     DELRAEGVPF RQVPVGIMVE LPSAAMIADR LAAECDFFSI GTNDLIQYTI GIDRQDKDVA       480
     YLYKPLHLAV LRLLKLICDA GRAAGVPVSM CGEMAGEPVN ALVLLGLGVS ELSMNGPSIP       540
     LVKRVVRAAR AEEGRALVDR LLALTTADDI EHEVQAEMAR RFPGLLDGDD EGPEPAGQG        599
//

If you have problems or comments...

PBIL Back to PBIL home page