(data stored in ACNUC7421 zone)

EMBL: CP000251.PE161

CP000251.PE161       Location/Qualifiers
FT   CDS             186114..187604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79939"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79939.1"
FT                   /translation="MSLTARELAQVVAELAPLAGAYVEAVRAHAERALTLSLRGRAGDA
FT                   LLLLSAEPDVTRLHAARRRPPQPDAPYAVQAVLRRELEGARLAGLETLPGDRVVALSFE
FT                   RAPARGGPVRLVAELTGRHGNLFLVDAAGIIRAAAARNLSQRRDLAVGRPYQPPSLPPA
FT                   GPGSDAGQGAPRFAPVPGTPFPLSAAIEDAYLAREEERRLAEGRRRLREPVRAALARAG
FT                   RALAKLADEAARVPAAEADRRAADLLKTHLRAVRRGATEVAVTEWTEEGPREVRVAVDP
FT                   ALTPQANLERYYRRYRRIVESAARVEARAAEVRAREAALRALLGRIDAAGAADLPRLER
FT                   EARRLAAGPRPAAPPRRKRDEPALPYRTFRSLSGATILVGRGAAENDALTLRVARGNDL
FT                   WLHARGLPGAHVVVRLDKAKAPDAETLVDAAHLAVHFSDARGAPQADVAYTRARFVKKP
FT                   KGSAPGAVTYSQEKVLLLRTEPGRVERLLAEEEGGQGG"
     MSLTARELAQ VVAELAPLAG AYVEAVRAHA ERALTLSLRG RAGDALLLLS AEPDVTRLHA        60
     ARRRPPQPDA PYAVQAVLRR ELEGARLAGL ETLPGDRVVA LSFERAPARG GPVRLVAELT       120
     GRHGNLFLVD AAGIIRAAAA RNLSQRRDLA VGRPYQPPSL PPAGPGSDAG QGAPRFAPVP       180
     GTPFPLSAAI EDAYLAREEE RRLAEGRRRL REPVRAALAR AGRALAKLAD EAARVPAAEA       240
     DRRAADLLKT HLRAVRRGAT EVAVTEWTEE GPREVRVAVD PALTPQANLE RYYRRYRRIV       300
     ESAARVEARA AEVRAREAAL RALLGRIDAA GAADLPRLER EARRLAAGPR PAAPPRRKRD       360
     EPALPYRTFR SLSGATILVG RGAAENDALT LRVARGNDLW LHARGLPGAH VVVRLDKAKA       420
     PDAETLVDAA HLAVHFSDAR GAPQADVAYT RARFVKKPKG SAPGAVTYSQ EKVLLLRTEP       480
     GRVERLLAEE EGGQGG                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page