(data stored in ACNUC7421 zone)

EMBL: CP000251.PE163

CP000251.PE163       Location/Qualifiers
FT   CDS             188646..190619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0164"
FT                   /product="Surface antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79941"
FT                   /db_xref="GOA:Q2IMA6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79941.1"
FT                   /translation="MAARAKPGEEPVLYGLEIQGTHALDAGDIASKLATQPSDRWAWQE
FT                   ARRLDADALAVDRKRVEAYYRERGFYDAKVVDVQVRPDGPGRAKVVMRVEEGEPILVRS
FT                   VEVTGLDAAPEAKARVGALPIRSGERFTERAYDGARGALLHALRNTGWADAAVTQRAQI
FT                   LPAEHAAEVRYEVTPGTRYRFGPVFVAGTAAVPRDRVREQAGIEIHPGDWFADDQLAKA
FT                   QARVFDLGVFGAVRVTRGAPDAQRGVVPIVVAVREVPFRTLRAGPGVGVQANTRWDVNG
FT                   TVGWTHRNFMGDLRKLQLELRAGYAWLVARPRKEGPIALATAEFSQPGAISRRIDATAR
FT                   LEIERGLEQAYDFWSERLRVGFPFRLARRLTLVPSWNLEVYQLENAVSTFDPTQPAKQG
FT                   PELQNCQGSVCLLSYLEQRVGWDGRNDPLNPRRGVWVMLAVQEGFNVGGYGYRYLRFLP
FT                   EARGFVPLGQKLVLAARARVGALVPVNQSGEPPIVARFTAGGPQSMRGYYTGRLAPMVL
FT                   RDGDWVPVGGNGLADGSLELRLDLTRTWGAALFVDAGNVSRPSGVPTAYRDVLDPTRLQ
FT                   WAGGLGLRYRTPFGPVRFDVGVQLPTNLAAGVPFDQRFPAVPSVENAGAPIYDKAGNVV
FT                   GTVPATHREPWIAFHLSIGEAF"
     MAARAKPGEE PVLYGLEIQG THALDAGDIA SKLATQPSDR WAWQEARRLD ADALAVDRKR        60
     VEAYYRERGF YDAKVVDVQV RPDGPGRAKV VMRVEEGEPI LVRSVEVTGL DAAPEAKARV       120
     GALPIRSGER FTERAYDGAR GALLHALRNT GWADAAVTQR AQILPAEHAA EVRYEVTPGT       180
     RYRFGPVFVA GTAAVPRDRV REQAGIEIHP GDWFADDQLA KAQARVFDLG VFGAVRVTRG       240
     APDAQRGVVP IVVAVREVPF RTLRAGPGVG VQANTRWDVN GTVGWTHRNF MGDLRKLQLE       300
     LRAGYAWLVA RPRKEGPIAL ATAEFSQPGA ISRRIDATAR LEIERGLEQA YDFWSERLRV       360
     GFPFRLARRL TLVPSWNLEV YQLENAVSTF DPTQPAKQGP ELQNCQGSVC LLSYLEQRVG       420
     WDGRNDPLNP RRGVWVMLAV QEGFNVGGYG YRYLRFLPEA RGFVPLGQKL VLAARARVGA       480
     LVPVNQSGEP PIVARFTAGG PQSMRGYYTG RLAPMVLRDG DWVPVGGNGL ADGSLELRLD       540
     LTRTWGAALF VDAGNVSRPS GVPTAYRDVL DPTRLQWAGG LGLRYRTPFG PVRFDVGVQL       600
     PTNLAAGVPF DQRFPAVPSV ENAGAPIYDK AGNVVGTVPA THREPWIAFH LSIGEAF          657
//

If you have problems or comments...

PBIL Back to PBIL home page