(data stored in ACNUC7421 zone)

EMBL: CP000251.PE165

CP000251.PE165       Location/Qualifiers
FT   CDS             complement(195111..196292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0166"
FT                   /product="integral membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79943"
FT                   /db_xref="GOA:Q2IMB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79943.1"
FT                   /translation="MTTRARLLTFGLAAAWLAIGYLNVARGASHAGAGYRFWSFQHHCY
FT                   SDVIALHGDRYLGGGRPLPYLEDRIEYPVLLGIALWLPSFVPGGALVHFTVTYALLALC
FT                   LFAALLALERLPGARPFWLGATPALVYYAGLNWDLLPIALLCAALLALARGRPGAGGAL
FT                   TALGTSAKLFPGVLAPPALLALAAEPSRAPLLRFGAGLAGALLAVNLPFALAAPEGWSW
FT                   FFRFNAGRGAENSIWDALGVGRGPWLEVLSTGPMLLAVALGCAAAWRAARAGGDARRAV
FT                   RLAVALALTAWIATNKIWSPQYALYGFLAGALAAAPTGLFLVLSAVSVADFHVAFEVRA
FT                   RRWDPWFRDHLFHPDGVVRSVLWLALAAWIARELWRCARAAPAAGTVSSPSTR"
     MTTRARLLTF GLAAAWLAIG YLNVARGASH AGAGYRFWSF QHHCYSDVIA LHGDRYLGGG        60
     RPLPYLEDRI EYPVLLGIAL WLPSFVPGGA LVHFTVTYAL LALCLFAALL ALERLPGARP       120
     FWLGATPALV YYAGLNWDLL PIALLCAALL ALARGRPGAG GALTALGTSA KLFPGVLAPP       180
     ALLALAAEPS RAPLLRFGAG LAGALLAVNL PFALAAPEGW SWFFRFNAGR GAENSIWDAL       240
     GVGRGPWLEV LSTGPMLLAV ALGCAAAWRA ARAGGDARRA VRLAVALALT AWIATNKIWS       300
     PQYALYGFLA GALAAAPTGL FLVLSAVSVA DFHVAFEVRA RRWDPWFRDH LFHPDGVVRS       360
     VLWLALAAWI ARELWRCARA APAAGTVSSP STR                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page