(data stored in ACNUC7421 zone)

EMBL: CP000251.PE167

CP000251.PE167       Location/Qualifiers
FT   CDS             197278..198258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0168"
FT                   /product="Transglutaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79945"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79945.1"
FT                   /translation="MIALAAAALLAALPAGEARYRVELSGEPVGAAELRVACAGARCRL
FT                   TFETWLRAPEEAGGAVRVRRVEAEVDREGRLAGAVRRTEDGAPRAASAAPGRVPASAAE
FT                   LAILASLAAGGGAAACLPAFDEEDGRTGLACAGPALPDGARALEVLGEREEVRAAPDGF
FT                   PAEVRLPDQGARFVRDAAAAPPARAPRLPVRVPGPAEADRARAFCGLAADPPAPAPPPA
FT                   AAPPAAPGPGDCRAQAAAWIAAARRAGLEARQAVGVAHDGEGFTWHAWAEVRGPAGWIA
FT                   VDPAFGEAPARGPRFTVARFTLGDPAARAEAGRRILACWGRGRVR"
     MIALAAAALL AALPAGEARY RVELSGEPVG AAELRVACAG ARCRLTFETW LRAPEEAGGA        60
     VRVRRVEAEV DREGRLAGAV RRTEDGAPRA ASAAPGRVPA SAAELAILAS LAAGGGAAAC       120
     LPAFDEEDGR TGLACAGPAL PDGARALEVL GEREEVRAAP DGFPAEVRLP DQGARFVRDA       180
     AAAPPARAPR LPVRVPGPAE ADRARAFCGL AADPPAPAPP PAAAPPAAPG PGDCRAQAAA       240
     WIAAARRAGL EARQAVGVAH DGEGFTWHAW AEVRGPAGWI AVDPAFGEAP ARGPRFTVAR       300
     FTLGDPAARA EAGRRILACW GRGRVR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page