(data stored in ACNUC7421 zone)

EMBL: CP000251.PE17

CP000251.PE17        Location/Qualifiers
FT   CDS             complement(20834..21325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0017"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79795"
FT                   /db_xref="GOA:Q2ILW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79795.1"
FT                   /translation="MNPTFDVMPDPPPRALVLHPEVSVRAELGWALGARDMASISAADG
FT                   ASGLALLLEELLSLDALVVALDLPGRDARAFADLVRRAGGEQELAIVVLASDPSPSLRD
FT                   ELAALGVDEVVDPRLGPDAVADAVVAAVQGRRAGAGIRPPRSSRGFGEPERLDPFRSAA
FT                   "
     MNPTFDVMPD PPPRALVLHP EVSVRAELGW ALGARDMASI SAADGASGLA LLLEELLSLD        60
     ALVVALDLPG RDARAFADLV RRAGGEQELA IVVLASDPSP SLRDELAALG VDEVVDPRLG       120
     PDAVADAVVA AVQGRRAGAG IRPPRSSRGF GEPERLDPFR SAA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page