(data stored in ACNUC7421 zone)

EMBL: CP000251.PE18

CP000251.PE18        Location/Qualifiers
FT   CDS             21603..21920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79796.1"
FT                   /translation="MDAWPAEAPPALGSLAEVRQRLDALLHQVTWTQHASTWLGRCEAG
FT                   PRSAELQLTPEADGQVRFVTIRRVERALVEELCAGLGVVAVDPQEMRLYRPEARAWSDA
FT                   R"
     MDAWPAEAPP ALGSLAEVRQ RLDALLHQVT WTQHASTWLG RCEAGPRSAE LQLTPEADGQ        60
     VRFVTIRRVE RALVEELCAG LGVVAVDPQE MRLYRPEARA WSDAR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page