(data stored in ACNUC7421 zone)

EMBL: CP000251.PE19

CP000251.PE19        Location/Qualifiers
FT   CDS             complement(21965..22762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79797.1"
FT                   /translation="MSTKTVACSLAFGVLLATPGRTAGQCTSADVPAGGIFTKLDAQGL
FT                   YSDLFSLTLVNLSDAALEGAADINATMAKYSVAYAPGMVRWDCADPPFYKLCSDAELNP
FT                   NTCQDVTQGFRPAPFTVRVERNDSAIWRGGWANDCYDGKIDFTWRTSTFQVKFKRQKVY
FT                   GGALAYPHYGTWTTLLPRTGSWCAPGTFCSGVWTTPHDYEMRNITTIAANELVVSLYST
FT                   DNQNLVVVLRETHWDGAQGDAYDGKRLDWVDNDSPRVPGDCNH"
     MSTKTVACSL AFGVLLATPG RTAGQCTSAD VPAGGIFTKL DAQGLYSDLF SLTLVNLSDA        60
     ALEGAADINA TMAKYSVAYA PGMVRWDCAD PPFYKLCSDA ELNPNTCQDV TQGFRPAPFT       120
     VRVERNDSAI WRGGWANDCY DGKIDFTWRT STFQVKFKRQ KVYGGALAYP HYGTWTTLLP       180
     RTGSWCAPGT FCSGVWTTPH DYEMRNITTI AANELVVSLY STDNQNLVVV LRETHWDGAQ       240
     GDAYDGKRLD WVDNDSPRVP GDCNH                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page