(data stored in ACNUC7421 zone)

EMBL: CP000251.PE193

CP000251.PE193       Location/Qualifiers
FT   CDS             221900..222718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79971.1"
FT                   /translation="MTDRSRRARPAAARPSPHDRHVLYERAVQHAGSELDLVDRVVRRG
FT                   GGTPRRLREDFSGTALLSAAWVRRGRDRSAVAVDLDASVHGWARAHRVPALGAAAARLR
FT                   LVEADVRDGPPGPFDAVIAFNFSYGVLQTRAALGGYLRSAAAALAPRGALLLDAYGGWD
FT                   AEKELTERRRIGGGVSYVWEQESFDPITRRVRCAIHFELPGGRRLRRAFTYDWRLWTIP
FT                   ELTELVGEAGLEPEVLWDVAPRGATRYLPRRSASNQGGWIAYVVGRPKRA"
     MTDRSRRARP AAARPSPHDR HVLYERAVQH AGSELDLVDR VVRRGGGTPR RLREDFSGTA        60
     LLSAAWVRRG RDRSAVAVDL DASVHGWARA HRVPALGAAA ARLRLVEADV RDGPPGPFDA       120
     VIAFNFSYGV LQTRAALGGY LRSAAAALAP RGALLLDAYG GWDAEKELTE RRRIGGGVSY       180
     VWEQESFDPI TRRVRCAIHF ELPGGRRLRR AFTYDWRLWT IPELTELVGE AGLEPEVLWD       240
     VAPRGATRYL PRRSASNQGG WIAYVVGRPK RA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page