(data stored in ACNUC7421 zone)

EMBL: CP000251.PE196

CP000251.PE196       Location/Qualifiers
FT   CDS             224090..225463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79974"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79974.1"
FT                   /translation="MDAQERDRLAGEVDALAAGLEEARGRHAAGLDPEPSLAPRFAARS
FT                   EAAHRRTVDALRAAGEEALAARVAALRAERAAAGHEEAWRAAEAAARGRGPDGEAPLAA
FT                   LELAALRERDRGRRLALARAAAEALEPAAAHREAACEAAARARAEVGHAPDWRVVVEGD
FT                   QLLAASDDAWRDVLAYRARTALEPLPAGDLARADLLHLLALGRWDGLFRAGMLPVALKL
FT                   TLEPLGLDGRARVDAADRPAQWPGVHVHGARISFRPRGGAGDWQDLVEGMGRALGAAAA
FT                   PPHRRDPALGAALGWLLGSLLLEPRWLADRAGVERRQAADVVRDLALRRLLALRARAAA
FT                   LRVATEVERGLSGARWREAYVEAMEAATGARWEGVRAARDADAAAHAAALRGADAGERL
FT                   RRDLRERLDEDWWRNPRAAPLLAGLLAAGALPPEPGDTAPAPGDAARALVARLEGKPA"
     MDAQERDRLA GEVDALAAGL EEARGRHAAG LDPEPSLAPR FAARSEAAHR RTVDALRAAG        60
     EEALAARVAA LRAERAAAGH EEAWRAAEAA ARGRGPDGEA PLAALELAAL RERDRGRRLA       120
     LARAAAEALE PAAAHREAAC EAAARARAEV GHAPDWRVVV EGDQLLAASD DAWRDVLAYR       180
     ARTALEPLPA GDLARADLLH LLALGRWDGL FRAGMLPVAL KLTLEPLGLD GRARVDAADR       240
     PAQWPGVHVH GARISFRPRG GAGDWQDLVE GMGRALGAAA APPHRRDPAL GAALGWLLGS       300
     LLLEPRWLAD RAGVERRQAA DVVRDLALRR LLALRARAAA LRVATEVERG LSGARWREAY       360
     VEAMEAATGA RWEGVRAARD ADAAAHAAAL RGADAGERLR RDLRERLDED WWRNPRAAPL       420
     LAGLLAAGAL PPEPGDTAPA PGDAARALVA RLEGKPA                                457
//

If you have problems or comments...

PBIL Back to PBIL home page