(data stored in ACNUC7421 zone)

EMBL: CP000251.PE198

CP000251.PE198       Location/Qualifiers
FT   CDS             226148..226600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0199"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79976"
FT                   /db_xref="GOA:Q2IME7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79976.1"
FT                   /translation="MAEWRENLIERDEDIRKLLAPVRRVAVLGMKTEAQSDQAAFYVPR
FT                   YLKDAGVEVVPVPVYYPDAKAILGAPVYRSVAAIPGPVDLVDVFRRPADVPAHVDDLVA
FT                   KKPAVVWLQLGIRNDAAAEALARAGIRVVQDRCLMVEWRRLGPAGR"
     MAEWRENLIE RDEDIRKLLA PVRRVAVLGM KTEAQSDQAA FYVPRYLKDA GVEVVPVPVY        60
     YPDAKAILGA PVYRSVAAIP GPVDLVDVFR RPADVPAHVD DLVAKKPAVV WLQLGIRNDA       120
     AAEALARAGI RVVQDRCLMV EWRRLGPAGR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page