(data stored in ACNUC7421 zone)

EMBL: CP000251.PE199

CP000251.PE199       Location/Qualifiers
FT   CDS             complement(226974..227924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0200"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79977"
FT                   /db_xref="GOA:Q2IME6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79977.1"
FT                   /translation="MKAFVRFAWSVLAYNLAVVVWGAFVRATGSGAGCGKHWPMCNGEV
FT                   VPRAPALETVIEFTHRATSGVALLLVLGLVVAARRTFPAGHAARRAAWASLALVLVEAL
FT                   VGAGLVLFGWVAKDDSAARGWVVAIHLTNTFLLIGAIALTAALAGRPRGLALRGHAGLA
FT                   AALGVAAGALVLTGASGAIAALGDTLFPATSFAQGLRQELSEEAHVLLRLRVLHPFVAV
FT                   FSTVALGWAARAALRARPDADTRSASFAVLLLAGLQLFAGVLNVALLAPVWMQLVHLLV
FT                   ADLLWVALMVLAAAALAPPDAAPAGARPDEAPALG"
     MKAFVRFAWS VLAYNLAVVV WGAFVRATGS GAGCGKHWPM CNGEVVPRAP ALETVIEFTH        60
     RATSGVALLL VLGLVVAARR TFPAGHAARR AAWASLALVL VEALVGAGLV LFGWVAKDDS       120
     AARGWVVAIH LTNTFLLIGA IALTAALAGR PRGLALRGHA GLAAALGVAA GALVLTGASG       180
     AIAALGDTLF PATSFAQGLR QELSEEAHVL LRLRVLHPFV AVFSTVALGW AARAALRARP       240
     DADTRSASFA VLLLAGLQLF AGVLNVALLA PVWMQLVHLL VADLLWVALM VLAAAALAPP       300
     DAAPAGARPD EAPALG                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page