(data stored in ACNUC7421 zone)

EMBL: CP000251.PE2

CP000251.PE2         Location/Qualifiers
FT   CDS             1811..2938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79780"
FT                   /db_xref="GOA:Q2ILU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79780.1"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFADVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERTVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRARFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
     MELKIGAQEL AKALGRSQGI VEKKSTMPIL SHVLLEAKKG DQLVVSATDL DLAVSSEHAC        60
     EVLKEGAVAV SARHLYEIVR ALPEQTVTLK KAHNNYLEVK SGPSEFRIVG LPAEDFPALP       120
     RFDKVPFADV DPALLLEMIE RTFFAVSNDE TRYNLNGVYF EPAGDALRLV ATDGHRLSLS       180
     ERTVGATFGL KRGVILPKKG LAELKKLLAE AAESGEEKPE AKLGFVENSA IFRRPNVVLV       240
     MRLIEGLFPD YKQVIPKAGE KVFKVGRARF LETLRRISLL SSDKAHAVKL DLSKDLLRVL       300
     SQNPDLGEAK EEVPVEYAGE PLKIGFNARY IMEVLQAVKS NEVVFELADD LSPGVLKGGE       360
     EADQGFTAVV MPMRI                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page