(data stored in ACNUC7421 zone)

EMBL: CP000251.PE20

CP000251.PE20        Location/Qualifiers
FT   CDS             complement(22777..24162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79798.1"
FT                   /translation="MSRTSRLHVLMVAILLPLAATAQTNYFPYGTAGEMQTDLVTYEGI
FT                   ARTVVVRILNLTPYRIEHTEATSTAYGDQYQVGTTLADVLDRDRLTAKAFFFAPVGVPA
FT                   VIPGVPPEAYTDGYVNTVTRPYEMVFSWNERAGRVEQSRVSWVVRGVQSWVCPPPPLGG
FT                   ECTPRHDDVHLGLWVTRPLDDPGESLYAGFFGSDFVGTMTMAVAFAGVITDPFNPLNWY
FT                   GLFIAAADMADPARFEEEQVAPDDGIEMYVASYPIPAPFTRSDPSQDCYLSNNNLVENE
FT                   LTAPSPALPDPRICTPQTVSGTADDGTDAQWADAAGPGASELITTIHVLRGRRYLPHSE
FT                   GGSACAGKWGSVPIVNVTIWTRDQYLSADVAGLAHASLASRPQRDPGAAKLVAEYRKFY
FT                   EKYDRAGLLAIREVVLALAPEAREQLRAAVLTVRSGGVLDKDAHKALHMVIVAARARLT
FT                   DDE"
     MSRTSRLHVL MVAILLPLAA TAQTNYFPYG TAGEMQTDLV TYEGIARTVV VRILNLTPYR        60
     IEHTEATSTA YGDQYQVGTT LADVLDRDRL TAKAFFFAPV GVPAVIPGVP PEAYTDGYVN       120
     TVTRPYEMVF SWNERAGRVE QSRVSWVVRG VQSWVCPPPP LGGECTPRHD DVHLGLWVTR       180
     PLDDPGESLY AGFFGSDFVG TMTMAVAFAG VITDPFNPLN WYGLFIAAAD MADPARFEEE       240
     QVAPDDGIEM YVASYPIPAP FTRSDPSQDC YLSNNNLVEN ELTAPSPALP DPRICTPQTV       300
     SGTADDGTDA QWADAAGPGA SELITTIHVL RGRRYLPHSE GGSACAGKWG SVPIVNVTIW       360
     TRDQYLSADV AGLAHASLAS RPQRDPGAAK LVAEYRKFYE KYDRAGLLAI REVVLALAPE       420
     AREQLRAAVL TVRSGGVLDK DAHKALHMVI VAARARLTDD E                           461
//

If you have problems or comments...

PBIL Back to PBIL home page