(data stored in ACNUC7421 zone)

EMBL: CP000251.PE201

CP000251.PE201       Location/Qualifiers
FT   CDS             complement(228738..229724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79979.1"
FT                   /translation="MRGCPAMRRASLALCLAALACSRSDPEARARVLGREDRPHEPAAA
FT                   AFDPEHPEAALALDADEAARRLGAFDWTAAAEWTVSAPGEEARQVHVTEHHQLRQSATG
FT                   EFEVRAEIDPGLGAGSSGGKHVIWTGGATYARALPAPFRERPTDRGRDARRFRDESFRL
FT                   AGTVAALYGPALRLEPAGEARLLGRAARRYRLSLAPAAKPPAPQPPPPGAPAPDPDTAR
FT                   RLAFLQGRVPVAADGELLADAETGVPLRVRLSGAFEVPNAPGVKARLELLAEVKALGGA
FT                   VGPVAAPAGALPDERKPAGPSTALEAAGLKKRGEEPARPAEPADEGE"
     MRGCPAMRRA SLALCLAALA CSRSDPEARA RVLGREDRPH EPAAAAFDPE HPEAALALDA        60
     DEAARRLGAF DWTAAAEWTV SAPGEEARQV HVTEHHQLRQ SATGEFEVRA EIDPGLGAGS       120
     SGGKHVIWTG GATYARALPA PFRERPTDRG RDARRFRDES FRLAGTVAAL YGPALRLEPA       180
     GEARLLGRAA RRYRLSLAPA AKPPAPQPPP PGAPAPDPDT ARRLAFLQGR VPVAADGELL       240
     ADAETGVPLR VRLSGAFEVP NAPGVKARLE LLAEVKALGG AVGPVAAPAG ALPDERKPAG       300
     PSTALEAAGL KKRGEEPARP AEPADEGE                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page