(data stored in ACNUC7421 zone)

EMBL: CP000251.PE203

CP000251.PE203       Location/Qualifiers
FT   CDS             complement(231700..232230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79981"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79981.1"
FT                   /translation="MAPSRAGPPPPGRGWGAAGPAARKAPLWAARPCADRVGSRPPTAR
FT                   RRRRCVIMPSPRVCGSCGRTRIILGAASVAPSARRPGETAMEAAIALEANAISLDGVLD
FT                   VPTARRLAAQLAAAAPGSLVRIDLTHVRELHDFGLAVLAQALSARGIRASFRGLGQHQL
FT                   RLLRYLGLDAVAA"
     MAPSRAGPPP PGRGWGAAGP AARKAPLWAA RPCADRVGSR PPTARRRRRC VIMPSPRVCG        60
     SCGRTRIILG AASVAPSARR PGETAMEAAI ALEANAISLD GVLDVPTARR LAAQLAAAAP       120
     GSLVRIDLTH VRELHDFGLA VLAQALSARG IRASFRGLGQ HQLRLLRYLG LDAVAA           176
//

If you have problems or comments...

PBIL Back to PBIL home page