(data stored in ACNUC7421 zone)

EMBL: CP000251.PE206

CP000251.PE206       Location/Qualifiers
FT   CDS             234013..234531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79984"
FT                   /db_xref="GOA:Q2IME8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79984.1"
FT                   /translation="MSAYVVDVEADGPIPGKYSMVSFGAVRVEPGLSRTFRGEVRPISD
FT                   LWLPEALAISGVTREQHLRFGEPGEVMADFERWIQETTRGKPVLFSDNLSFDWQYVNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDGHAQWKHLRATAHDHDPVNDAKANAGVLLQLV
FT                   DMGLKLNLK"
     MSAYVVDVEA DGPIPGKYSM VSFGAVRVEP GLSRTFRGEV RPISDLWLPE ALAISGVTRE        60
     QHLRFGEPGE VMADFERWIQ ETTRGKPVLF SDNLSFDWQY VNWYFHTYLG RNPFGWSGRR       120
     IGDLYCGMVK DGHAQWKHLR ATAHDHDPVN DAKANAGVLL QLVDMGLKLN LK               172
//

If you have problems or comments...

PBIL Back to PBIL home page