(data stored in ACNUC7421 zone)

EMBL: CP000251.PE207

CP000251.PE207       Location/Qualifiers
FT   CDS             234539..235147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0208"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79985"
FT                   /db_xref="GOA:Q2IMF6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79985.1"
FT                   /translation="MTLFAQGALLGLSAAAQPGPYQAYLLAQSLRNGAVRTLPVVLVPL
FT                   TSDPPVIAAVLVALAQVPAGLLRALQLLGGAVVLWLAFSALRGLRAPLAAPEAKAPPRG
FT                   FWRAVLLNFTNPNAWIFWSAVGGPVLAAAWRDGRAEAGGFLAGFYAFLLGGNAALVAAA
FT                   GGLGRLGPRTQRALTAISGLALLAFGLWQLAKGLAGPRA"
     MTLFAQGALL GLSAAAQPGP YQAYLLAQSL RNGAVRTLPV VLVPLTSDPP VIAAVLVALA        60
     QVPAGLLRAL QLLGGAVVLW LAFSALRGLR APLAAPEAKA PPRGFWRAVL LNFTNPNAWI       120
     FWSAVGGPVL AAAWRDGRAE AGGFLAGFYA FLLGGNAALV AAAGGLGRLG PRTQRALTAI       180
     SGLALLAFGL WQLAKGLAGP RA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page