(data stored in ACNUC7421 zone)

EMBL: CP000251.PE210

CP000251.PE210       Location/Qualifiers
FT   CDS             237061..238200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0211"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79988"
FT                   /db_xref="GOA:Q2IMF3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79988.1"
FT                   /translation="MSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELAEVSR
FT                   GRKVVLVSSGAVALGAERLGLARSRGKPWDLPTKQACAAAGQPHLMAAWGEALGRHGLV
FT                   TAQVLLTADDLASRKRFLNARRTFERLLDAGAVPVVNENDTVAVDELKVGDNDTLAALV
FT                   AGCVEADAVAMLTDVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVGGMIT
FT                   KVKAARRLGAQGVVTALLSGRRARALPALLAGEPVGTVFAPGAHRLSSRQGWLAAAARG
FT                   KGVILVDAGARRALVEQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAGYAAD
FT                   EVRRIAGLKTGEIERALGYKYLDEIVHRNDLVVLETGRE"
     MSRSALRRVK RLVVKVGTGT LTDRAGRFDR DNCARLASEL AEVSRGRKVV LVSSGAVALG        60
     AERLGLARSR GKPWDLPTKQ ACAAAGQPHL MAAWGEALGR HGLVTAQVLL TADDLASRKR       120
     FLNARRTFER LLDAGAVPVV NENDTVAVDE LKVGDNDTLA ALVAGCVEAD AVAMLTDVDG       180
     LYDRNPAEPG ARLLRDVPRV TAEIERSAGG AGSERSVGGM ITKVKAARRL GAQGVVTALL       240
     SGRRARALPA LLAGEPVGTV FAPGAHRLSS RQGWLAAAAR GKGVILVDAG ARRALVEQGR       300
     SLLPSGVRGV QGQFGVGDPV DVAVDPARPF ARGLAGYAAD EVRRIAGLKT GEIERALGYK       360
     YLDEIVHRND LVVLETGRE                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page