(data stored in ACNUC7421 zone)

EMBL: CP000251.PE215

CP000251.PE215       Location/Qualifiers
FT   CDS             complement(242781..243671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0216"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79993"
FT                   /db_xref="GOA:Q2IMG4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79993.1"
FT                   /translation="MRAAVRTRIVATYLAVAALWGSTWMAIRIGLEDLPPLRFAGVRMA
FT                   IAALVLAPFALRGGAWREVVGPARAQLALVAVLQIALPYGLMFVAQQWVPSGLAAVLFA
FT                   SFPVWIALLARALVPGETLTPARVASALLGIAGVAVLQLPHLGDLEGSGRLLLGGALVV
FT                   LSSMIVALANVLVRRHLAAVSPLAMTAGQTAVGAVLLLAAAALLEQGRPAAFTASAVAA
FT                   LAWLAVFGTALTYVGLYWLVPRVPMAAIGALPLLDTSVAVTLGALVLHEPVGWNLALGG
FT                   GMVLAAAALTIPRRR"
     MRAAVRTRIV ATYLAVAALW GSTWMAIRIG LEDLPPLRFA GVRMAIAALV LAPFALRGGA        60
     WREVVGPARA QLALVAVLQI ALPYGLMFVA QQWVPSGLAA VLFASFPVWI ALLARALVPG       120
     ETLTPARVAS ALLGIAGVAV LQLPHLGDLE GSGRLLLGGA LVVLSSMIVA LANVLVRRHL       180
     AAVSPLAMTA GQTAVGAVLL LAAAALLEQG RPAAFTASAV AALAWLAVFG TALTYVGLYW       240
     LVPRVPMAAI GALPLLDTSV AVTLGALVLH EPVGWNLALG GGMVLAAAAL TIPRRR           296
//

If you have problems or comments...

PBIL Back to PBIL home page