(data stored in ACNUC7421 zone)

EMBL: CP000251.PE218

CP000251.PE218       Location/Qualifiers
FT   CDS             248841..249257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0219"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79996"
FT                   /db_xref="GOA:Q2IMG1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79996.1"
FT                   /translation="MAITWDPTLALGIEEIDAQHEELFRRVDALLESVQERRSAEETRR
FT                   MLAFLDAYVVEHFGAEEALMQAHRYPGLAAQRAEHAGFAADLAALREELERDGMNALLV
FT                   VRVNARVATWLFEHISRSDRAFGRFLLAAPAARA"
     MAITWDPTLA LGIEEIDAQH EELFRRVDAL LESVQERRSA EETRRMLAFL DAYVVEHFGA        60
     EEALMQAHRY PGLAAQRAEH AGFAADLAAL REELERDGMN ALLVVRVNAR VATWLFEHIS       120
     RSDRAFGRFL LAAPAARA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page