(data stored in ACNUC7421 zone)

EMBL: CP000251.PE224

CP000251.PE224       Location/Qualifiers
FT   CDS             254791..255933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0225"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80002"
FT                   /db_xref="GOA:Q2IMH1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80002.1"
FT                   /translation="MPRATGPRRGCRLLGLALAAAVALPGCKRGGGSTAEAAQEQPPVA
FT                   LAPENVAVVSSRRLQSGPEVAGTLHARRTATLRAEVGGAVAEVRVEAGERVKAGQLLAR
FT                   IDASALQDAVRAARSAVTSAQNALRVAESSARRAHTLAREGAMAEQDAERAEAQLEAAR
FT                   AQVEDAKARLAAAEQQAGKTAVRAPFAGVVSERNVSSGDVVSSGAALYTVIDPSRLQFE
FT                   GSVPAASVGALAPGAPVDFAVTGFGGRRFDGHIERVNPAVDPSTGQVRVYVDVPNADGR
FT                   LLAGLYAQGRVASQASEALAAPATAVDATSTPPTVMKVQDGKVQKVAVEIALRDDVAGA
FT                   VGFRSGVKQGDVLVLGSARGALADGTPVRVVEDPRAQQSN"
     MPRATGPRRG CRLLGLALAA AVALPGCKRG GGSTAEAAQE QPPVALAPEN VAVVSSRRLQ        60
     SGPEVAGTLH ARRTATLRAE VGGAVAEVRV EAGERVKAGQ LLARIDASAL QDAVRAARSA       120
     VTSAQNALRV AESSARRAHT LAREGAMAEQ DAERAEAQLE AARAQVEDAK ARLAAAEQQA       180
     GKTAVRAPFA GVVSERNVSS GDVVSSGAAL YTVIDPSRLQ FEGSVPAASV GALAPGAPVD       240
     FAVTGFGGRR FDGHIERVNP AVDPSTGQVR VYVDVPNADG RLLAGLYAQG RVASQASEAL       300
     AAPATAVDAT STPPTVMKVQ DGKVQKVAVE IALRDDVAGA VGFRSGVKQG DVLVLGSARG       360
     ALADGTPVRV VEDPRAQQSN                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page