(data stored in ACNUC7421 zone)

EMBL: CP000251.PE237

CP000251.PE237       Location/Qualifiers
FT   CDS             274713..278432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80015"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80015.1"
FT                   /translation="MSRAARRGPPRIPGVAAALAALALACAAPRAEQAEPGRATREGLA
FT                   ALEQNDVARAEARLGPASRVRDPWARFGASLLARRALDGEAEAQRLLATVEAGPDEPIA
FT                   LVALRRLSELAERGPALAAQVDAGVLRLGAGGRLHGLAAYRARVARVTAAEVLGDHDAA
FT                   AQARRENGAVSAWSIAGPFAAHHALDFGAPIPPDRGELPASVPGRAGGPAVPTRALPAP
FT                   DGTVALDGEPAAGDLFALATDVDLARGGRYLVTLGTQLSARLVVDGALVHERRAFAAWL
FT                   PGLVHLPVELARGRHRVVLEVTRGAPSTGIHLAFARADGAASDARFAAPPPGPPPAPPV
FT                   ARPRAEPALTPRALALALEPDVGAATARLLAARDALVNDREAAKVLLAEALALRPEAAA
FT                   LRAARADATADDPTLDEQVARARAEADLREALRLDPGDAEARAELAALLRGAERHDDAE
FT                   AVLAGLAPEPAARPAGIAARARAAQARGLLERAEGLAAEALRSAGSCDAADLAYELAVR
FT                   RGAAAREDEAMAVLSRCRGGRERLAAHLRRRGDPVAERAALDPVVRARPWAVEPGLTRA
FT                   DALVAAGETRRATAALEAIAAIWPRDARVQRRLADARELSGDAPGARAARERALALDPA
FT                   DLQLRRALALEDGTEVLADVAADPRAAIRAYEAAGRRNGASTVMVLDAAYVDVHPGGAA
FT                   TERTQQIVHVLDQQGVEQFGEVTVPAGADVLALRTVKPDGTTLEPERAGSAKGSVSLAG
FT                   LAPGDYVELDYVRAVQSPPGLEGYAADPFYFQVPGSRLFRSLYVVRAPAGLGLEADAHG
FT                   MPAPAPVRDGGREVLRAERRDVPAIVPEPDAPGGAEYLPFLSVGTGGGRAALQRAVADA
FT                   LPERTRATAELRAFAREIAAGGGGPAQLARAAYARVAQAVLGSGGGMGEDASVALSRGR
FT                   GSRLAVLKAVLAELGIESRVALVRPYSADPAPYRFPALGLYAAPLLRVRAGGATFWLDP
FT                   TARHAPFGAFPAVLAGCEALVLPEAGEAPEVDRTPESPLVEEGRETTARLVLAADGSAE
FT                   ASGTDRYLGYGGAELKAALERLDASQRRQAVEGMLGRVLRGVTVTDVAFAGEDDPAAPL
FT                   EIRWKARVPELARAVEGGLVLDQPLFPARLGARLVRVASRQTPLLLATPERQVQRIEVV
FT                   PPRGLGVTADAPRTASSPSGSFTRTERVDGGTLVRDERLELRRGRIAPEHHAELAAFAA
FT                   AVDQAQERPLLLAR"
     MSRAARRGPP RIPGVAAALA ALALACAAPR AEQAEPGRAT REGLAALEQN DVARAEARLG        60
     PASRVRDPWA RFGASLLARR ALDGEAEAQR LLATVEAGPD EPIALVALRR LSELAERGPA       120
     LAAQVDAGVL RLGAGGRLHG LAAYRARVAR VTAAEVLGDH DAAAQARREN GAVSAWSIAG       180
     PFAAHHALDF GAPIPPDRGE LPASVPGRAG GPAVPTRALP APDGTVALDG EPAAGDLFAL       240
     ATDVDLARGG RYLVTLGTQL SARLVVDGAL VHERRAFAAW LPGLVHLPVE LARGRHRVVL       300
     EVTRGAPSTG IHLAFARADG AASDARFAAP PPGPPPAPPV ARPRAEPALT PRALALALEP       360
     DVGAATARLL AARDALVNDR EAAKVLLAEA LALRPEAAAL RAARADATAD DPTLDEQVAR       420
     ARAEADLREA LRLDPGDAEA RAELAALLRG AERHDDAEAV LAGLAPEPAA RPAGIAARAR       480
     AAQARGLLER AEGLAAEALR SAGSCDAADL AYELAVRRGA AAREDEAMAV LSRCRGGRER       540
     LAAHLRRRGD PVAERAALDP VVRARPWAVE PGLTRADALV AAGETRRATA ALEAIAAIWP       600
     RDARVQRRLA DARELSGDAP GARAARERAL ALDPADLQLR RALALEDGTE VLADVAADPR       660
     AAIRAYEAAG RRNGASTVMV LDAAYVDVHP GGAATERTQQ IVHVLDQQGV EQFGEVTVPA       720
     GADVLALRTV KPDGTTLEPE RAGSAKGSVS LAGLAPGDYV ELDYVRAVQS PPGLEGYAAD       780
     PFYFQVPGSR LFRSLYVVRA PAGLGLEADA HGMPAPAPVR DGGREVLRAE RRDVPAIVPE       840
     PDAPGGAEYL PFLSVGTGGG RAALQRAVAD ALPERTRATA ELRAFAREIA AGGGGPAQLA       900
     RAAYARVAQA VLGSGGGMGE DASVALSRGR GSRLAVLKAV LAELGIESRV ALVRPYSADP       960
     APYRFPALGL YAAPLLRVRA GGATFWLDPT ARHAPFGAFP AVLAGCEALV LPEAGEAPEV      1020
     DRTPESPLVE EGRETTARLV LAADGSAEAS GTDRYLGYGG AELKAALERL DASQRRQAVE      1080
     GMLGRVLRGV TVTDVAFAGE DDPAAPLEIR WKARVPELAR AVEGGLVLDQ PLFPARLGAR      1140
     LVRVASRQTP LLLATPERQV QRIEVVPPRG LGVTADAPRT ASSPSGSFTR TERVDGGTLV      1200
     RDERLELRRG RIAPEHHAEL AAFAAAVDQA QERPLLLAR                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page