(data stored in ACNUC7421 zone)

EMBL: CP000251.PE238

CP000251.PE238       Location/Qualifiers
FT   CDS             complement(278803..279414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80016"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80016.1"
FT                   /translation="MRRLLALLVLGLAAGAGLGLALRLGRAPALPDPPAVATRIREVAR
FT                   LEALDVTLYKKVAFSPEPVEAGSLWGDVAGWLRHVFRTPHGKAIVFADAHLGLDLARLD
FT                   ASRVRVSGRTVEIALPPLEVRIALRPGETEVIGSNLDSAETARLLELARAAFEREVQAD
FT                   AALRARARSSAERAIRGLLLGLGFAEVRFVDALPAAAPTS"
     MRRLLALLVL GLAAGAGLGL ALRLGRAPAL PDPPAVATRI REVARLEALD VTLYKKVAFS        60
     PEPVEAGSLW GDVAGWLRHV FRTPHGKAIV FADAHLGLDL ARLDASRVRV SGRTVEIALP       120
     PLEVRIALRP GETEVIGSNL DSAETARLLE LARAAFEREV QADAALRARA RSSAERAIRG       180
     LLLGLGFAEV RFVDALPAAA PTS                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page