(data stored in ACNUC7421 zone)

EMBL: CP000251.PE239

CP000251.PE239       Location/Qualifiers
FT   CDS             complement(279424..280002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0240"
FT                   /product="TfoX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80017"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80017.1"
FT                   /translation="MPISPSFVEHAVDLLAALGPVQARRMFGGVGLYCDGVMFGLLDGD
FT                   ELFLKTDGETRPWFLEAGCRMWIYPGMYETSYYRPPDDAHEDAEAMLPWARLALDAAIR
FT                   AQAARAAKARAPRGAGAKARPARRAKRAKPGKAAKGTAKAAKTKRPAASKRTRASVGAR
FT                   RTKRTAAHTRRPRTRPAKRGRARPARPPR"
     MPISPSFVEH AVDLLAALGP VQARRMFGGV GLYCDGVMFG LLDGDELFLK TDGETRPWFL        60
     EAGCRMWIYP GMYETSYYRP PDDAHEDAEA MLPWARLALD AAIRAQAARA AKARAPRGAG       120
     AKARPARRAK RAKPGKAAKG TAKAAKTKRP AASKRTRASV GARRTKRTAA HTRRPRTRPA       180
     KRGRARPARP PR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page