(data stored in ACNUC7421 zone)

EMBL: CP000251.PE247

CP000251.PE247       Location/Qualifiers
FT   CDS             290570..293074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0249"
FT                   /product="PBS lyase HEAT-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80025"
FT                   /db_xref="GOA:Q2IMI9"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80025.1"
FT                   /translation="MRRDLAQLLVEEGAIPAAAAERAAARQAEAGGALDTALLELGLAG
FT                   EDVVLRALERASGLPAAPDWAWDASDARARRVFPSRVAERHGLAPFALDGRELSLVATH
FT                   PVDLALLDEISFMLSLHLTPHVGPEWRVRALIHRLYGGALPPRLAALAAGGAAAATPGE
FT                   EAASPEPAVAAPDADAPEPDAPPTPEPDPAPPAPASSGPAAAAFDDAAPLEPLAAAVAQ
FT                   VLESADFSFLDAPPATPSPAPAGAAHPAPSARPSAGSGPADAPGAPRGERAESPPEPAP
FT                   RPAPRRMGETAAPPPAPAPGAPGRWTRAEAQAALAAASERDEVLRVVLRYAREFFAFAA
FT                   VFAVSRDAVAGHDALGEEEGEDARALCRSVAIYTSDPGVFHTAIETHAPHLGPISPEPD
FT                   GNRAILDGLGRGTPRTVLVHPVVLRQRTACLLYADNGPAAVSPRRLADLVLFLAGLAPA
FT                   LERVIQARKRARGAAAGEAPAAPPAPPPPEAAPVPVPSPSPARAAAPPRPTPAPVAAPS
FT                   AEPWQAHEPAAALADLEVDIDLFEEELGAAAPPSGAVRFDPEAEVTALLETDPGSLDRI
FT                   AGLARLAAFPEAALPVVWARLPGPIESDDDGASPTALGPLAAALAALGPAAVPAMVEVL
FT                   RDRDPVRRRIAATVLGAAGDPSTFPALAERVLDADPRVAGAAIAALAAHRRHPEMRAVP
FT                   EKLRRALLSGVAARTTFAARALGALRDAESVPLLVQVLESSEREPAEAAAAALAEITLQ
FT                   RLGTDPRRWLAWWKQNRGRGRAEWLLSGLTSAEREVRAAAAEELARAAPPPVSYQVDAP
FT                   AAEREAAARLWAGWWARSGLVL"
     MRRDLAQLLV EEGAIPAAAA ERAAARQAEA GGALDTALLE LGLAGEDVVL RALERASGLP        60
     AAPDWAWDAS DARARRVFPS RVAERHGLAP FALDGRELSL VATHPVDLAL LDEISFMLSL       120
     HLTPHVGPEW RVRALIHRLY GGALPPRLAA LAAGGAAAAT PGEEAASPEP AVAAPDADAP       180
     EPDAPPTPEP DPAPPAPASS GPAAAAFDDA APLEPLAAAV AQVLESADFS FLDAPPATPS       240
     PAPAGAAHPA PSARPSAGSG PADAPGAPRG ERAESPPEPA PRPAPRRMGE TAAPPPAPAP       300
     GAPGRWTRAE AQAALAAASE RDEVLRVVLR YAREFFAFAA VFAVSRDAVA GHDALGEEEG       360
     EDARALCRSV AIYTSDPGVF HTAIETHAPH LGPISPEPDG NRAILDGLGR GTPRTVLVHP       420
     VVLRQRTACL LYADNGPAAV SPRRLADLVL FLAGLAPALE RVIQARKRAR GAAAGEAPAA       480
     PPAPPPPEAA PVPVPSPSPA RAAAPPRPTP APVAAPSAEP WQAHEPAAAL ADLEVDIDLF       540
     EEELGAAAPP SGAVRFDPEA EVTALLETDP GSLDRIAGLA RLAAFPEAAL PVVWARLPGP       600
     IESDDDGASP TALGPLAAAL AALGPAAVPA MVEVLRDRDP VRRRIAATVL GAAGDPSTFP       660
     ALAERVLDAD PRVAGAAIAA LAAHRRHPEM RAVPEKLRRA LLSGVAARTT FAARALGALR       720
     DAESVPLLVQ VLESSEREPA EAAAAALAEI TLQRLGTDPR RWLAWWKQNR GRGRAEWLLS       780
     GLTSAEREVR AAAAEELARA APPPVSYQVD APAAEREAAA RLWAGWWARS GLVL             834
//

If you have problems or comments...

PBIL Back to PBIL home page