(data stored in ACNUC7421 zone)

EMBL: CP000251.PE249

CP000251.PE249       Location/Qualifiers
FT   CDS             complement(295094..295750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80027"
FT                   /db_xref="GOA:Q2IMJ7"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80027.1"
FT                   /translation="MPMRTHELHPSIVHAPLALLPAAAIADLVATARPRDRGLDAVGRT
FT                   LWWSAAAGGLAAGLAGMAASQEIEVRSEHARDAMFLHGIGNLGLVLAAFGVAAWRSRNR
FT                   ACLTTALTGLAATAAAGYTAYLGGELVYGHGAGVRAMGGAASEAPPLFSAEAPGRLARD
FT                   AVRGLRWLLSRGARAVTGRERVDRTALGPLAEAGTGAEPPPPGARTDGGLGASPM"
     MPMRTHELHP SIVHAPLALL PAAAIADLVA TARPRDRGLD AVGRTLWWSA AAGGLAAGLA        60
     GMAASQEIEV RSEHARDAMF LHGIGNLGLV LAAFGVAAWR SRNRACLTTA LTGLAATAAA       120
     GYTAYLGGEL VYGHGAGVRA MGGAASEAPP LFSAEAPGRL ARDAVRGLRW LLSRGARAVT       180
     GRERVDRTAL GPLAEAGTGA EPPPPGARTD GGLGASPM                               218
//

If you have problems or comments...

PBIL Back to PBIL home page