(data stored in ACNUC7421 zone)

EMBL: CP000251.PE25

CP000251.PE25        Location/Qualifiers
FT   CDS             complement(28777..29313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79803"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79803.1"
FT                   /translation="MYLSSRAATVVAAALLTACAGARRAEAPPAALTARELTIVDAQGR
FT                   PRLRLGAPLPPPKGAERRAVDAFGIQFMDSDGYEVAGLGMLEPVDIRGLCFDIKDAYEA
FT                   MCVGLVKGEPSITFRHDWKERITMGVEQGVASIVLHDAQASPRIRLEVDRDGKTRVEGV
FT                   STTSPTPPASGSAAP"
     MYLSSRAATV VAAALLTACA GARRAEAPPA ALTARELTIV DAQGRPRLRL GAPLPPPKGA        60
     ERRAVDAFGI QFMDSDGYEV AGLGMLEPVD IRGLCFDIKD AYEAMCVGLV KGEPSITFRH       120
     DWKERITMGV EQGVASIVLH DAQASPRIRL EVDRDGKTRV EGVSTTSPTP PASGSAAP         178
//

If you have problems or comments...

PBIL Back to PBIL home page