(data stored in ACNUC7421 zone)

EMBL: CP000251.PE252

CP000251.PE252       Location/Qualifiers
FT   CDS             297653..299029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80030.1"
FT                   /translation="MPPDHAPRRTAVGSARRAMTTAPAPSPAPLVVAVDMGYGHLRAAS
FT                   ALADALGTEVLKVDRAPVAGPEEERLWQRVRRGYEAISRLSQVPVAGRPLAWALDSITD
FT                   IPRLHPRRDLSAPTRGVRALERLARGALGAGLVARLRAEGAPLLTTFYSPAVVADRAGI
FT                   ERVYCVATDTDLNRIWAPLEPARTRIQYLVPTRRAARRLLAYGVPAHRITFTGFPLPDA
FT                   LLGGPSLPVLKRNLAARLVRLDPTGEFRRSMPEELAVFLGALPREEEGKPAQLTFAVGG
FT                   AGAQAAMADAFLPGLRPALESGAMRLALVAGTRPEVEARFREALRRAGLEPLLGGAVEI
FT                   LRAPSFGEYYARFNALLARTDVLWTKPSELTFYGALGLPLVLAPPVGVHERYNRRWARE
FT                   SGAGLKQRDARFAAEWLSDWLADGLLAAAAWAGYMRLPKFGLYRVLEALGRTPAANVAP
FT                   "
     MPPDHAPRRT AVGSARRAMT TAPAPSPAPL VVAVDMGYGH LRAASALADA LGTEVLKVDR        60
     APVAGPEEER LWQRVRRGYE AISRLSQVPV AGRPLAWALD SITDIPRLHP RRDLSAPTRG       120
     VRALERLARG ALGAGLVARL RAEGAPLLTT FYSPAVVADR AGIERVYCVA TDTDLNRIWA       180
     PLEPARTRIQ YLVPTRRAAR RLLAYGVPAH RITFTGFPLP DALLGGPSLP VLKRNLAARL       240
     VRLDPTGEFR RSMPEELAVF LGALPREEEG KPAQLTFAVG GAGAQAAMAD AFLPGLRPAL       300
     ESGAMRLALV AGTRPEVEAR FREALRRAGL EPLLGGAVEI LRAPSFGEYY ARFNALLART       360
     DVLWTKPSEL TFYGALGLPL VLAPPVGVHE RYNRRWARES GAGLKQRDAR FAAEWLSDWL       420
     ADGLLAAAAW AGYMRLPKFG LYRVLEALGR TPAANVAP                               458
//

If you have problems or comments...

PBIL Back to PBIL home page