(data stored in ACNUC7421 zone)

EMBL: CP000251.PE254

CP000251.PE254       Location/Qualifiers
FT   CDS             complement(300521..301738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0256"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80032"
FT                   /db_xref="GOA:Q2IMK1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80032.1"
FT                   /translation="MAPHDAPGHEAVQAAPAPGRVDVLSALDRLLAIEPEEHALRRIVS
FT                   ALADAVPAVVAAALLVPDDEGRLAIAAEVGGEGRPPAPADGGAALAAGAPWVRADPGWP
FT                   LPAGARAGAAAAAGGGALLVMGTRGEGGFEPGALALLRLAADRAGLALERGRLRRARES
FT                   AEEAARRALAEVDSRRRAVDYILGIVGHDLRNPLGAVHMSAALLQKRGGLEGWQARAIE
FT                   RMRSSAGRMARIIADLLSYTRTRLGNGMPIDRRPARLDEIARRPVDELGAVNPGREITV
FT                   AVAGDLSGSWDPDRLEQVISNLVSNAVDHGDPDSPVRVELSGEPDACVLRVRNTGPPVP
FT                   PEVLEHLFEPFSRPPDEKSRKGSGLGLGLYISREIVRGHGGEISIASDGETVITARLPR
FT                   SPTPAP"
     MAPHDAPGHE AVQAAPAPGR VDVLSALDRL LAIEPEEHAL RRIVSALADA VPAVVAAALL        60
     VPDDEGRLAI AAEVGGEGRP PAPADGGAAL AAGAPWVRAD PGWPLPAGAR AGAAAAAGGG       120
     ALLVMGTRGE GGFEPGALAL LRLAADRAGL ALERGRLRRA RESAEEAARR ALAEVDSRRR       180
     AVDYILGIVG HDLRNPLGAV HMSAALLQKR GGLEGWQARA IERMRSSAGR MARIIADLLS       240
     YTRTRLGNGM PIDRRPARLD EIARRPVDEL GAVNPGREIT VAVAGDLSGS WDPDRLEQVI       300
     SNLVSNAVDH GDPDSPVRVE LSGEPDACVL RVRNTGPPVP PEVLEHLFEP FSRPPDEKSR       360
     KGSGLGLGLY ISREIVRGHG GEISIASDGE TVITARLPRS PTPAP                       405
//

If you have problems or comments...

PBIL Back to PBIL home page