(data stored in ACNUC7421 zone)

EMBL: CP000251.PE258

CP000251.PE258       Location/Qualifiers
FT   CDS             305724..307541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0260"
FT                   /product="DnaJ like heat shock protein with
FT                   tetratricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80036"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80036.1"
FT                   /translation="MSDAPPKPPGETPPPRTRPDVPAGPPRLERVPDGYRPPAVPRAAA
FT                   PAARPPPPPPPAPTYGLAAREVGADAAIAAGLAHQGALAADSALRLYGLAAATRASGRL
FT                   TLAPEGRSYALVFRRGAVEHAASSDPADDLGRFLLRKGVLRPEQLVEAEAARAAAGGDL
FT                   AAALVGARLVPPGDVAALLAEHGLALVARALAVEDGTWAWEPGVGPPPSGFPLGPPFAA
FT                   LCAAVRALELPAVKRRLGDREERAASRMAGRVRIEDLRLTPQEARAAALVDGERSPAEI
FT                   AAASPADAAAVLRLSLLLGELDLLAFGAPRRARAPAPGVAPPPARAATPTPTPRPTPTP
FT                   VPPPAAAPAAAAPRPPPPRPPPVAAAPAPRTTPAPAAVRRATALEPAALRATLASLQDA
FT                   DHFQVLGVKRDAPAAQVKVAYFQLAKLYHPDAIPTDAPADVRKLCADLFGRVSAAWAEL
FT                   GDEARRAQYLQELQSGGAPEVDVMGILQAENLFQTGTQLVKARRYDEALAKFLEALQLN
FT                   PEEPEFGIWKAWCEFLRADDKKRQQAQSAAAVEAGLKKNPRCAPGYLFLGQMAKVLGDL
FT                   ALAERHLRRGLAAAPDNADLARELKYLRK"
     MSDAPPKPPG ETPPPRTRPD VPAGPPRLER VPDGYRPPAV PRAAAPAARP PPPPPPAPTY        60
     GLAAREVGAD AAIAAGLAHQ GALAADSALR LYGLAAATRA SGRLTLAPEG RSYALVFRRG       120
     AVEHAASSDP ADDLGRFLLR KGVLRPEQLV EAEAARAAAG GDLAAALVGA RLVPPGDVAA       180
     LLAEHGLALV ARALAVEDGT WAWEPGVGPP PSGFPLGPPF AALCAAVRAL ELPAVKRRLG       240
     DREERAASRM AGRVRIEDLR LTPQEARAAA LVDGERSPAE IAAASPADAA AVLRLSLLLG       300
     ELDLLAFGAP RRARAPAPGV APPPARAATP TPTPRPTPTP VPPPAAAPAA AAPRPPPPRP       360
     PPVAAAPAPR TTPAPAAVRR ATALEPAALR ATLASLQDAD HFQVLGVKRD APAAQVKVAY       420
     FQLAKLYHPD AIPTDAPADV RKLCADLFGR VSAAWAELGD EARRAQYLQE LQSGGAPEVD       480
     VMGILQAENL FQTGTQLVKA RRYDEALAKF LEALQLNPEE PEFGIWKAWC EFLRADDKKR       540
     QQAQSAAAVE AGLKKNPRCA PGYLFLGQMA KVLGDLALAE RHLRRGLAAA PDNADLAREL       600
     KYLRK                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page