(data stored in ACNUC7421 zone)

EMBL: CP000251.PE26

CP000251.PE26        Location/Qualifiers
FT   CDS             29510..30589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79804"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79804.1"
FT                   /translation="MERTGRGFVGAVLLACLAVATSARGAESYTVVAGGLESPRGLAFG
FT                   PGGRLYVAQAGSGGTTGKISEIRGAGTASPAIRDVVTGLVSAGDEGEFVGVDGLSALGN
FT                   GTLYAIMALSNEATGFASALGHLLQVNPAGRVRSVADVGDFDFDWTAEHVELAPDDFPD
FT                   ANPYAVLAAGGRVYVADAGANTLDLVRPDGSIQVLAYFPNPLAPDGTPVKDATPTCIAE
FT                   GPDGALYVGTLALAASLRFGPSAAVYRVDPGAALPGDLEVTLNLATPWATGLPPINGCA
FT                   FGPDGSFYASLLATGPDLANPHSDVVKIPFDDPTARELLTGGELMFPAGVAVGPDGAVY
FT                   VSNHAAFVPDGQVVRLARR"
     MERTGRGFVG AVLLACLAVA TSARGAESYT VVAGGLESPR GLAFGPGGRL YVAQAGSGGT        60
     TGKISEIRGA GTASPAIRDV VTGLVSAGDE GEFVGVDGLS ALGNGTLYAI MALSNEATGF       120
     ASALGHLLQV NPAGRVRSVA DVGDFDFDWT AEHVELAPDD FPDANPYAVL AAGGRVYVAD       180
     AGANTLDLVR PDGSIQVLAY FPNPLAPDGT PVKDATPTCI AEGPDGALYV GTLALAASLR       240
     FGPSAAVYRV DPGAALPGDL EVTLNLATPW ATGLPPINGC AFGPDGSFYA SLLATGPDLA       300
     NPHSDVVKIP FDDPTARELL TGGELMFPAG VAVGPDGAVY VSNHAAFVPD GQVVRLARR        359
//

If you have problems or comments...

PBIL Back to PBIL home page