(data stored in ACNUC7421 zone)

EMBL: CP000251.PE264

CP000251.PE264       Location/Qualifiers
FT   CDS             complement(310979..311425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0266"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80042"
FT                   /db_xref="GOA:Q2IMK9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80042.1"
FT                   /translation="MAMGLGSKRPVTDINVTPLIDVVLVLLIIFMVLTPLAEKQKFIRV
FT                   PEYQPEMQPVPPDSVPPDQTVLTALGNGNVLLNKQEMTINDAMQRLHVAYDGRPSKVMF
FT                   FNAEDSVRYEQAVKVLDAAHGAGVNTIGMMTDPPLTGGAAPEQQ"
     MAMGLGSKRP VTDINVTPLI DVVLVLLIIF MVLTPLAEKQ KFIRVPEYQP EMQPVPPDSV        60
     PPDQTVLTAL GNGNVLLNKQ EMTINDAMQR LHVAYDGRPS KVMFFNAEDS VRYEQAVKVL       120
     DAAHGAGVNT IGMMTDPPLT GGAAPEQQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page