(data stored in ACNUC7421 zone)

EMBL: CP000251.PE266

CP000251.PE266       Location/Qualifiers
FT   CDS             complement(311883..312641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0268"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80044"
FT                   /db_xref="GOA:Q2IML5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80044.1"
FT                   /translation="MSLQVIQTLQQLASAQATPEVSFDLLHMWKTMGPFAKFIAGVLAV
FT                   MSIYSLGVMAERLVTFARAQKASRQFAAALRDLLPAAKFGEAVELSRKLKRGHLPKVLG
FT                   LAIEEYSHGVEALRTHGPRDVGQFDVIAAVNRAVERSSLRTVNDLRRGLGALATVGSTA
FT                   PFVGLLGTVAGIITAFQAMAATGSGGLGSVSAGIAEALVTTAFGLLVAIPAVMMFNYLT
FT                   NRVEDMQVDITDSATELMDFFMKEGRGEAK"
     MSLQVIQTLQ QLASAQATPE VSFDLLHMWK TMGPFAKFIA GVLAVMSIYS LGVMAERLVT        60
     FARAQKASRQ FAAALRDLLP AAKFGEAVEL SRKLKRGHLP KVLGLAIEEY SHGVEALRTH       120
     GPRDVGQFDV IAAVNRAVER SSLRTVNDLR RGLGALATVG STAPFVGLLG TVAGIITAFQ       180
     AMAATGSGGL GSVSAGIAEA LVTTAFGLLV AIPAVMMFNY LTNRVEDMQV DITDSATELM       240
     DFFMKEGRGE AK                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page