(data stored in ACNUC7421 zone)

EMBL: CP000251.PE269

CP000251.PE269       Location/Qualifiers
FT   CDS             317355..318146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80047.1"
FT                   /translation="MKTLTKLALTLIAVAGLQACDPYEDENKGVPSVINVISSDSGTAY
FT                   EGTNTGTSWTISTPSAFVLFVKVNAGKLLDGASIQATTDDCTPANDWLSVNGAGPGNWM
FT                   SCYYPQSPAGFEGASVVLYPGPSISTVDSWFSLSELEPGIFNLAGTVSDKQGHPLAIDV
FT                   NAFVNDLAAAQSDTAGTEITTEFSDAGVNMTNVQLWEAPDVSGAPGTWTAVATTTPYVH
FT                   AGVAVGSTWWYKVTADTNGFPATAASFETAPVSVTTEPPAP"
     MKTLTKLALT LIAVAGLQAC DPYEDENKGV PSVINVISSD SGTAYEGTNT GTSWTISTPS        60
     AFVLFVKVNA GKLLDGASIQ ATTDDCTPAN DWLSVNGAGP GNWMSCYYPQ SPAGFEGASV       120
     VLYPGPSIST VDSWFSLSEL EPGIFNLAGT VSDKQGHPLA IDVNAFVNDL AAAQSDTAGT       180
     EITTEFSDAG VNMTNVQLWE APDVSGAPGT WTAVATTTPY VHAGVAVGST WWYKVTADTN       240
     GFPATAASFE TAPVSVTTEP PAP                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page