(data stored in ACNUC7421 zone)

EMBL: CP000251.PE271

CP000251.PE271       Location/Qualifiers
FT   CDS             complement(319122..320027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0273"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80049"
FT                   /db_xref="GOA:Q2IML9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IML9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80049.1"
FT                   /translation="MKALLEAGVHFGHQTKRWNPKMKPFIFGARNGIYIIDLQKTVGLA
FT                   RNALRFVSDSVAKGGSVLFVGTKKQAQDAIREEASRSGQFFVTNRWLGGTLTNFKTVKQ
FT                   GIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKELSRLPSALFVIDTKK
FT                   EHIAVHEANRLGIPVVAVVDTNCDPEGIDYVIPGNDDAIRSIRLFTGKVAEACIEGKGR
FT                   YSAWVAEHGGHDERREQEDRDAASERGHKDRRDRRDRRGGPRERREPREDRAAASANVE
FT                   VVRKGEVAPAAAPEAAPAKE"
     MKALLEAGVH FGHQTKRWNP KMKPFIFGAR NGIYIIDLQK TVGLARNALR FVSDSVAKGG        60
     SVLFVGTKKQ AQDAIREEAS RSGQFFVTNR WLGGTLTNFK TVKQGIDRLK TIEKMAADGT       120
     YERLPKKEVA QLEREREKLE KNLGGIKELS RLPSALFVID TKKEHIAVHE ANRLGIPVVA       180
     VVDTNCDPEG IDYVIPGNDD AIRSIRLFTG KVAEACIEGK GRYSAWVAEH GGHDERREQE       240
     DRDAASERGH KDRRDRRDRR GGPRERREPR EDRAAASANV EVVRKGEVAP AAAPEAAPAK       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page