(data stored in ACNUC7421 zone)

EMBL: CP000251.PE278

CP000251.PE278       Location/Qualifiers
FT   CDS             327055..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0280"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80056"
FT                   /db_xref="GOA:Q2IMM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80056.1"
FT                   /translation="MASEKASNPKARYQRILLKLSGEALMGDGKYGISPKTLTSIAHDV
FT                   KDVVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINSMALQDALEKIGV
FT                   PTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIVVF
FT                   DLTQRGNVRKVVLGEEIGTTVGRPSARNA"
     MASEKASNPK ARYQRILLKL SGEALMGDGK YGISPKTLTS IAHDVKDVVD LGVEVALTIG        60
     GGNIFRGVSG ATEGMDRSSA DYMGMLATVI NSMALQDALE KIGVPTRVQS AIEMHQVAEP       120
     YIRRRAIRHL EKGRVVIFAA GTGNPYFTTD TAASLRAMEI HADVLLKATK VDGVYTDDPK       180
     KNPAATKFKQ LSYIDVLKKN LKVMDSTAIS LCMDNDLPIV VFDLTQRGNV RKVVLGEEIG       240
     TTVGRPSARN A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page