(data stored in ACNUC7421 zone)

EMBL: CP000251.PE281

CP000251.PE281       Location/Qualifiers
FT   CDS             complement(328631..329059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80059"
FT                   /db_xref="GOA:Q2IMM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80059.1"
FT                   /translation="MRELLVFLHILSAATWIGAALWVPGDVKRTVALGRPFVEQLAARA
FT                   RPALKLDLYAGFAVLVTGVLLIGVDGGHPRTGILVGFAATLARLLVVGFASMPAWRRVE
FT                   GAVASGDLAAATAPARRLAMLGGIGHALWAIALAGMVF"
     MRELLVFLHI LSAATWIGAA LWVPGDVKRT VALGRPFVEQ LAARARPALK LDLYAGFAVL        60
     VTGVLLIGVD GGHPRTGILV GFAATLARLL VVGFASMPAW RRVEGAVASG DLAAATAPAR       120
     RLAMLGGIGH ALWAIALAGM VF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page