(data stored in ACNUC7421 zone)

EMBL: CP000251.PE295

CP000251.PE295       Location/Qualifiers
FT   CDS             345460..347595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0297"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80073"
FT                   /db_xref="GOA:Q2IMN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80073.1"
FT                   /translation="MAPDAAAPAAVPGPGPGPGDAPRRGRRAPWGGAAAAAAVLVVGGA
FT                   LLQQHEIAEERGRRRAVLERADLAARAIEDDLSRSLAAAHALAALVRHADIDRFEEVAD
FT                   DLLAHYGGISSLQLAPGGVLTRIHPLAGNEAALGLDLLADPGHRASAERTIQSRELTAE
FT                   GPFELRQGGQGVVGRIAVFRPAPGGGEAFWGFVAVAVRLPEVVSRTRVAALSAAGLDWA
FT                   LRRDGAAQPFASSGGALPRLAVAVKVRLPGEAWELDVAPREGWVRWGGLVMPAALLVLV
FT                   AAAIGLLAQRLLRLPEELRRAVDERTAALALANRRLAAELVERQRAEEARQAAEAQARH
FT                   GQKMEAVGLLAGGIAHDFNNLLTGILGYAELLGEPGTAADEAAAGIRQAARRGAALTRQ
FT                   LLGFARRGKYQQVPVDLHALVREVSELLERTLDKRIAIRHQLAAGTAVVRGDPDQLQQV
FT                   VLNLAVNARDAMPSGGTLTFETAEVELDAEGTRARPGLAPGRHVAITVADTGVGIPAAV
FT                   RERVFDPFFTTKPAGQGTGMGLAMVYGIVQNHGGWVGFESEEGRGARFTVLLPEAPAAE
FT                   RDEGVPAGAPEHGAGRVLVADDERGVRETTARLLRRLGYDALPAASLAEALEVQGRGAL
FT                   DLALVDLAMPAGDGPETLRALRRAQPELPAVLMTGYGLDARVRDALQGGFRGILHKPFS
FT                   VEELAAEVARAVRRRGA"
     MAPDAAAPAA VPGPGPGPGD APRRGRRAPW GGAAAAAAVL VVGGALLQQH EIAEERGRRR        60
     AVLERADLAA RAIEDDLSRS LAAAHALAAL VRHADIDRFE EVADDLLAHY GGISSLQLAP       120
     GGVLTRIHPL AGNEAALGLD LLADPGHRAS AERTIQSREL TAEGPFELRQ GGQGVVGRIA       180
     VFRPAPGGGE AFWGFVAVAV RLPEVVSRTR VAALSAAGLD WALRRDGAAQ PFASSGGALP       240
     RLAVAVKVRL PGEAWELDVA PREGWVRWGG LVMPAALLVL VAAAIGLLAQ RLLRLPEELR       300
     RAVDERTAAL ALANRRLAAE LVERQRAEEA RQAAEAQARH GQKMEAVGLL AGGIAHDFNN       360
     LLTGILGYAE LLGEPGTAAD EAAAGIRQAA RRGAALTRQL LGFARRGKYQ QVPVDLHALV       420
     REVSELLERT LDKRIAIRHQ LAAGTAVVRG DPDQLQQVVL NLAVNARDAM PSGGTLTFET       480
     AEVELDAEGT RARPGLAPGR HVAITVADTG VGIPAAVRER VFDPFFTTKP AGQGTGMGLA       540
     MVYGIVQNHG GWVGFESEEG RGARFTVLLP EAPAAERDEG VPAGAPEHGA GRVLVADDER       600
     GVRETTARLL RRLGYDALPA ASLAEALEVQ GRGALDLALV DLAMPAGDGP ETLRALRRAQ       660
     PELPAVLMTG YGLDARVRDA LQGGFRGILH KPFSVEELAA EVARAVRRRG A                711
//

If you have problems or comments...

PBIL Back to PBIL home page