(data stored in ACNUC7421 zone)

EMBL: CP000251.PE3

CP000251.PE3         Location/Qualifiers
FT   CDS             2958..4076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79781"
FT                   /db_xref="GOA:Q2ILU8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ILU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79781.1"
FT                   /translation="MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGAADAAVAGDFEGPGGVRRVAVQVAAGGRTASLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRSGTAEVEASFREPLVRAGARLLVRRRDLVAELAPRLRAAFAEISGPAAPEADLA
FT                   YRAAGGVEVGHPEAEVAARLARALETRLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTTTDRRLIEPAAGPDTAFYEVRSGVVSPLVS"
     MKLLSLHVQD FRNLAAVELA PSPRATVLLG ENGQGKTNLL EAIYFLTTLK PLRAVRLAEL        60
     VRFGAADAAV AGDFEGPGGV RRVAVQVAAG GRTASLDGKA LGSGARLDDY FEGLASVCFS       120
     PDDLLLVKAG PDGRRRFLDR AAFNRWPAVL GEAREYVRAL RARNAALRSG TAEVEASFRE       180
     PLVRAGARLL VRRRDLVAEL APRLRAAFAE ISGPAAPEAD LAYRAAGGVE VGHPEAEVAA       240
     RLARALETRL ERDREKGFTS AGPHMDDLVL ALGGKGARLY GSQGQQRALV LALKIAEIEN       300
     LRAALGRPPL LLLDDVSSEL DPAKNRFLLG YLAALPAQAF LTTTDRRLIE PAAGPDTAFY       360
     EVRSGVVSPL VS                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page