(data stored in ACNUC7421 zone)

EMBL: CP000251.PE301

CP000251.PE301       Location/Qualifiers
FT   CDS             355792..356271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0303"
FT                   /product="protein of unknown function DUF456"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80079"
FT                   /db_xref="GOA:Q2IMP9"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80079.1"
FT                   /translation="MEILLYALGAAALVAGVAGVVLPVLPGSLLLVAGAVLVAWAGDFQ
FT                   RVGWGTVAVAAVLSVAIWAVDWLASVLGAKAFGASGWAVAGAGVGLLVGFFLGLPGIVL
FT                   GPAVGAIAFEYARNPDVKRALKAGAGAFLGFVLGSAVKVALAFAVVGAVALALIW"
     MEILLYALGA AALVAGVAGV VLPVLPGSLL LVAGAVLVAW AGDFQRVGWG TVAVAAVLSV        60
     AIWAVDWLAS VLGAKAFGAS GWAVAGAGVG LLVGFFLGLP GIVLGPAVGA IAFEYARNPD       120
     VKRALKAGAG AFLGFVLGSA VKVALAFAVV GAVALALIW                              159
//

If you have problems or comments...

PBIL Back to PBIL home page