(data stored in ACNUC7421 zone)

EMBL: CP000251.PE309

CP000251.PE309       Location/Qualifiers
FT   CDS             362684..363454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80087"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80087.1"
FT                   /translation="MQPWETVERAHAPDGTELVLARRGGEWVVRAAGHVLMSSRAHGSE
FT                   EALAALALERCARPRAVLLGGLGLGFTLRALLDRLPPDAKVVVAELLPELAAWNRGPVA
FT                   DLAGRPLEDPRVRVQHGDVLARISEARGAYDAILLDVDNGPSALAHAGNHRLYGDAGVH
FT                   ACRAALRQGGTLAVWSAGPDERYLSRLERAGLEARSVTVPARGRATQGGGGVRHVVFLA
FT                   TAPAQGGARRPVTPPRAGGAGRGPGPHARGARGR"
     MQPWETVERA HAPDGTELVL ARRGGEWVVR AAGHVLMSSR AHGSEEALAA LALERCARPR        60
     AVLLGGLGLG FTLRALLDRL PPDAKVVVAE LLPELAAWNR GPVADLAGRP LEDPRVRVQH       120
     GDVLARISEA RGAYDAILLD VDNGPSALAH AGNHRLYGDA GVHACRAALR QGGTLAVWSA       180
     GPDERYLSRL ERAGLEARSV TVPARGRATQ GGGGVRHVVF LATAPAQGGA RRPVTPPRAG       240
     GAGRGPGPHA RGARGR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page